Bacterial taxon 909946
Locus STM474_0220
Protein WP_000272193.1
DUF3461 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 128 aa, Gene yaeh, UniProt E8XI09
>WP_000272193.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF3461 family protein
MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKSVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDLRHLESVVANKISEIEADLDKLTRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 247,549 | -0.13 | 0.97 | ○○○○○ 0.11 | 0.109773370555936 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 247,549 | 0.26 | 0.76 | ○○○○○ 0.31 | 0.310111675233518 | 23637626 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)