Bacterial taxon 909946
Locus STM474_3072
Protein WP_001118109.1
DUF3561 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 118 aa, Gene ygbe, UniProt E8X8L1
>WP_001118109.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF3561 family protein
MPGMVKVTGFNMRNSHNITFTRSDAFMVDDDATSAFPGAVVGFVSWLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVIIGIALHLLVKGKILFSIMFTLLAVGALFGALFIWLLG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,094,809 | 0.33 | 0.95 | ○○○○○ 0.35 | 0.346019200443061 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,094,860 | 0.74 | 0.83 | ○○○○○ 0.56 | 0.56270569824361 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,094,809 | 1.1 | 0.14 | ○○○○○ 0.75 | 0.745822967943325 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,094,860 | 1.1 | 0.17 | ○○○○○ 0.75 | 0.746676768085297 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,094,809 | 2.43 | 0.27 | ○○○○○ 1.44 | 1.43794181783785 | 23637626 |
Retrieved 5 of 5 entries in 2 ms
(Link to these results)