Bacterial taxon 909946
Locus STM474_4219
Protein WP_000828052.1
DUF3829 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 366 aa, Gene yiiG, UniProt E8XKA4
>WP_000828052.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF3829 domain-containing protein
MKRNLLSSAIIIALMTLGATGCDDNNVKTEATPAASSQPATPAPSQTPETQSGESPAQPSAAKPETATQPPVAKPETPAQPEVDAEEVYSEKMDVYIDCFNKLQLPVQHSLARYADWVKDFKKGPTGKESLVYGIYGITESYITNCQKEMKQVAALTPLLEPIDGVAVSYIDSAAALGNTINEMEKYYTQENYKDDAFAKGKALHQTLLKNIEDFKPVSEKYHEAIQEINDRRQLTQLKRIEEAEGKTFNYYSLAVMISAKQINKVISADTFDAEAMMKKVAELETMIAQLKEVNTDGRNSSFISSAADYQLQAKKYIRRIRDNVEYSDFEKKRVQDPATGWMVADSYPASLRSYNEMVDDYNRLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,272,779 | -2.94 | 1.1e-8 | ●●○○○ -1.35 | -1.34960014855028 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,272,774 | -2.39 | 0.04 | ●●○○○ -1.07 | -1.0657012020671 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,272,779 | -0.88 | 0.8 | ●○○○○ -0.28 | -0.277900001657537 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,272,774 | -0.58 | 0.89 | ●○○○○ -0.12 | -0.124179793887825 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,272,784 | -0.46 | 0.74 | ●○○○○ -0.06 | -0.0632218257944986 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,272,784 | -0.17 | 0.96 | ○○○○○ 0.09 | 0.0866046266588424 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,272,779 | -0.11 | 0.99 | ○○○○○ 0.12 | 0.122097264585558 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,272,774 | 0.25 | 0.69 | ○○○○○ 0.31 | 0.306598936974464 | 23637626 |
Retrieved 8 of 8 entries in 1.4 ms
(Link to these results)