Bacterial taxon 909946
Locus STM474_2489
Protein WP_000030904.1
DUF406 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 94 aa, Gene yfcZ, UniProt E8XF45
>WP_000030904.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF406 family protein
MSKCSADETPVCCCMDVGTIMDNSDCTASYSRVFATRAEAEETLAALTEKARSVESEPCQITPTFTEESEGVRLDIDFVFACEAETLIFQLGLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,499,653 | 0.88 | 0.78 | ○○○○○ 0.63 | 0.634463599116124 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,499,653 | 1.47 | 0.2 | ○○○○○ 0.94 | 0.9404428790616 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)