Bacterial taxon 909946
Locus STM474_4686
Protein WP_001687450.1
DUF4102 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 95 aa, Gene n/a, UniProt E8XBP0
>WP_001687450.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4102 domain-containing protein
MALTDLAIRHARLPGKAYRLFDCHGFYIQVNPSGSKLWYLKFRFGNKKNRMALGPYPLISLALAREKQADIRRLILEGINPAEKRREDKRGGEPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,752,080 | -0.76 | 0.53 | ●○○○○ -0.22 | -0.219027130470969 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,752,080 | 0.44 | 0.95 | ○○○○○ 0.41 | 0.405989902433495 | 23637626 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)