Bacterial taxon 909946
Locus STM474_4528
Protein WP_000558210.1
DUF4156 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 117 aa, Gene yjeI, UniProt E8X9Y2
>WP_000558210.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4156 domain-containing protein
MHVKYLAGIVGAALLMAGCSSSNELTAAGQNVRFVEDKPGAECQLIGTATGKQSNWFSGQHGEEGGSMRGAANDLRNQAAAMGGNVLYGVSSPSQGMLSSFVPTASEMNGQVYKCPN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,597,861 | -0.61 | 0.82 | ●○○○○ -0.14 | -0.141934190012718 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,597,861 | -0.1 | 0.89 | ○○○○○ 0.13 | 0.126253794190099 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,597,861 | 1.58 | 0.32 | ○○○○○ 1 | 0.995168267625406 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)