Bacterial taxon 909946
Locus STM474_0586
Protein WP_000362180.1
DUF417 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 186 aa, Gene n/a, UniProt E8X937
>WP_000362180.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF417 domain-containing protein
MDKYLRLLSQGDRLGLTLIRLSIAIVFIWIGLLKFVPYEADSITPFVANSPFMSFFYEHPEEYRQHLTHEGELKPEERAWQTANNTYAFSDGLGVVELIIAALVLANPVSRWLGLAGGVLAFLTPFVTLSFLITTPEVWVMPLGDAHYGFPYLSGAGRLVLKDTLMLAGAVMIMADSARSLLLQRQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 621,967 | -0.66 | 0.24 | ●○○○○ -0.16 | -0.16331124358944 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 621,967 | -0.26 | 0.86 | ○○○○○ 0.04 | 0.0439618377320362 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 621,967 | 0.12 | 1 | ○○○○○ 0.24 | 0.238985269372495 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)