Bacterial taxon 909946
Locus STM474_3647
Protein WP_000472323.1
DUF4223 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 56 aa, Gene n/a, UniProt E8XEI3
>WP_000472323.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4223 domain-containing protein
MFKFVKIAVVAGVLATLTACTGHIENKKNNCSYDYLLHPAISISKIIGGCGPAADQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,657,492 | -2.54 | 0.005 | ●●○○○ -1.14 | -1.14371027030099 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,657,492 | -1.79 | 0.00077 | ●○○○○ -0.75 | -0.7525101045755 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,657,492 | -0.92 | 0.7 | ●○○○○ -0.3 | -0.301159105797016 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)