Bacterial taxon 909946
Locus STM474_3127
Protein WP_000203913.1
DUF423 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 131 aa, Gene ygdD, UniProt E8X8R6
>WP_000203913.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF423 domain-containing protein
MTSRFMLIVAAISGFIYVALGAFGAHVLSKTLGVVEMGWIQTGLQYQAFHTLAIFGLAVAMQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAYITPVGGVSFLVGWALLLIGAIRMKRKGASHE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,155,457 | -0.34 | 0.93 | ●○○○○ -0 | -0.000507540503117533 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,155,457 | 0.22 | 0.79 | ○○○○○ 0.29 | 0.291434897225781 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,155,457 | 0.22 | 0.89 | ○○○○○ 0.29 | 0.29165313092884 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)