Bacterial taxon 909946
Locus STM474_3050
Protein WP_001070479.1
DUF4440 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 126 aa, Gene n/a, UniProt E8XL38
>WP_001070479.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4440 domain-containing protein
MNPYKEEIIHAHAAIENWLSKGVGSLEALIARFAADFTMITPGGVCLDYPALGAFFQAQRACRPGLVIVVEHIDLVAEWPEGAALRYRERQQLPGQAETVRWSTVILKRERGRIVWRHLHETTVTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,075,799 | -0.81 | 0.23 | ●○○○○ -0.24 | -0.242922088749718 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,075,799 | 0.04 | 0.99 | ○○○○○ 0.2 | 0.195966272762016 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,075,799 | 0.72 | 0.84 | ○○○○○ 0.55 | 0.552004502772596 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)