Bacterial taxon 909946
Locus STM474_4125
Protein WP_000812765.1
DUF484 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 235 aa, Gene yigA, UniProt E8XJD6
>WP_000812765.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF484 domain-containing protein
MKQPEEELQETLTELDDRAVVDYLRHHPEFFIRNAHAVEAMRVPHPVRGTVSLVEWHMARARNHINVLEENMTLLMEQAHANESLFYRLLHLQSRLVAADSLDEMLVRFHRWARDLGLAGATLRLFPDRWRLGAPSRYTHLALNRQAFEPLRIQRLGQSQHYLGPLNGPELLVVLPEAKAVGSVAMSMMGSDGGLGVILFSSRDPHHYQPGQGTQLLQEIALMLPELLERWIKRV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,174,938 | -3.71 | 0.00034 | ●●○○○ -1.75 | -1.74893241826983 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,174,938 | -1.62 | 0.024 | ●○○○○ -0.66 | -0.664052542530407 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,174,938 | -1.53 | 0.12 | ●○○○○ -0.62 | -0.618951420012696 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,175,135 | -0.78 | 0.21 | ●○○○○ -0.23 | -0.226749507612596 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,175,001 | -0.39 | 0.9 | ●○○○○ -0.03 | -0.0262241509651481 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,175,135 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.161246180399231 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,174,824 | 0.48 | 0.76 | ○○○○○ 0.43 | 0.426532718453838 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,174,824 | 0.73 | 0.21 | ○○○○○ 0.55 | 0.55424841287256 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,174,824 | 0.75 | 0.83 | ○○○○○ 0.57 | 0.56536636931392 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,175,135 | 1.89 | 0.41 | ○○○○○ 1.16 | 1.15645347524875 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,175,001 | 2.31 | 0.17 | ○○○○○ 1.38 | 1.37709450896078 | 23637626 |
Retrieved 11 of 11 entries in 1.5 ms
(Link to these results)