Bacterial taxon 909946
Locus STM474_3842
Protein WP_000794981.1
DUF4862 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 310 aa, Gene n/a, UniProt E8XFY4
>WP_000794981.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4862 family protein
MKNNTGYIIGAYPCAPSFHQKSEEEETEFWRQLSDTPDIRGLEQPCLEHLHPLGDEWLLRHTPGNWQIVVTAIMETMRRRSENGGFGLASSDEEQRKACVEYYRHLYQKINKINGNNTGKVIALELHAAPLAGNPNVAQATDAFARSLKEIANWDWSCDLVLEHCDAMTGPAPRKGFLPLVNVLETIADYDISVCINWARSAIEGRDTSLPLIHTQQAKQAGKLGALMFSGTTLDGEYGEWQDLHAPFAPFCPQSLMTEKHVKELITAAAPELLQFTGIKLLEINASADINHRINILRDGINMMKKATRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,879,238 | -3.45 | 6.4e-19 | ●●○○○ -1.62 | -1.61593659764274 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,878,485 | -3.42 | 9.0e-14 | ●●○○○ -1.6 | -1.59653428140112 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,879,238 | -2.47 | 0.0063 | ●●○○○ -1.11 | -1.10748739745804 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,878,956 | -1.79 | 0.00085 | ●○○○○ -0.75 | -0.753535466048483 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,879,187 | -1.74 | 0.00098 | ●○○○○ -0.72 | -0.723934031963993 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,878,965 | -1.99 | 0.1 | ●○○○○ -0.86 | -0.858293932417922 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,878,956 | -1.18 | 0.19 | ●○○○○ -0.44 | -0.436580671977543 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,878,485 | -0.69 | 0.57 | ●○○○○ -0.18 | -0.179354732434235 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,879,238 | -0.52 | 0.86 | ●○○○○ -0.09 | -0.0912703561804449 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,878,956 | -0.46 | 0.87 | ●○○○○ -0.06 | -0.0604906582699357 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,878,485 | -0.26 | 0.94 | ○○○○○ 0.04 | 0.0435365854466641 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,878,965 | -0.11 | 0.87 | ○○○○○ 0.12 | 0.120899347813184 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,879,187 | -0.05 | 0.99 | ○○○○○ 0.15 | 0.150601147776816 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,878,965 | 1.58 | 0.34 | ○○○○○ 1 | 0.998992644052806 | 23637626 |
Retrieved 14 of 14 entries in 1.1 ms
(Link to these results)