Bacterial taxon 909946
Locus STM474_1394
Protein WP_001060729.1
DUF523 and DUF1722 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 319 aa, Gene n/a, UniProt E8XH83
>WP_001060729.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF523 and DUF1722 domain-containing protein
MNNKPVVGISGCLTGATVRFDGGHKRMDFVMNSLAPWVAYKPICPEVAIGLPVPRPALRLIQTTCGDIRMRYSHAPHDDVTERMNAFADRFLPTIGELAGFIVCAKSPSCGMERVRLYDEKGNRGRKAGTGLFTAAMMDKYPWLPIEEDGRLHDPVLRENFIARIFALHELNALRAQGLSRHSLLAFHSRYKLQLLAHHQAGYREIGPFVARLHEWDDLDAFFVRYREKLMAILRHPASRKNHTNVLMHIQGYFHRALNSRQRAELREVILGYRAGRLPILAPLTLLKHYLAEHPDDYLRSQNYFEPYPDTLGLRLAIT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,431,719 | -1.32 | 0.25 | ●○○○○ -0.51 | -0.506130981544518 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,431,581 | -1.07 | 0.33 | ●○○○○ -0.38 | -0.376292549768642 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,431,725 | -0.35 | 0.65 | ●○○○○ -0.01 | -0.00628135117508179 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,431,806 | -0.05 | 0.94 | ○○○○○ 0.15 | 0.150858720608727 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,431,806 | 0.03 | 1 | ○○○○○ 0.19 | 0.19332942006145 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,431,638 | 0.1 | 0.95 | ○○○○○ 0.23 | 0.230092807092413 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,431,719 | 0.2 | 0.73 | ○○○○○ 0.28 | 0.282031561164784 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,431,581 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.305444434912884 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,431,581 | 0.27 | 0.74 | ○○○○○ 0.32 | 0.317416981893224 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,431,725 | 0.36 | 0.78 | ○○○○○ 0.37 | 0.366023456456692 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,431,719 | 0.66 | 0.87 | ○○○○○ 0.52 | 0.520923571683519 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,431,638 | 0.79 | 0.81 | ○○○○○ 0.59 | 0.589497709268018 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,431,725 | 1.12 | 0.67 | ○○○○○ 0.76 | 0.760708425463687 | 23637626 |
Retrieved 13 of 13 entries in 1.3 ms
(Link to these results)