Bacterial taxon 909946
Locus STM474_3503
Protein WP_001739021.1
DUF695 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 250 aa, Gene n/a, UniProt E8XD46
>WP_001739021.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF695 domain-containing protein
MLSNKWEFFITTVDDHVTGIRVDIGAIQDEKFDRLIHTGFLRVHYTNCYENGLPQPDETQSLNRIEDWLDEKGKTFPIWLVGVVTQQGWRDFVFMSEEDLNWEKTLDKLLAGGPEISFSYRESHNDKGNFYRQFLYPTRYDWNWIHDSRVCRGLQEQGDDLTLPRAIDYYATLPTEVAARDLAQDIAALPYGITLVSIRMNDPQQGFMASFISTDAPQQWHMTEITCQLTDLAEKHGGSFDGWGAPVVQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,533,385 | -1.87 | 0.00022 | ●○○○○ -0.79 | -0.794584014344156 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,533,385 | -0.05 | 0.99 | ○○○○○ 0.15 | 0.153375712874787 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,533,385 | 0.17 | 0.92 | ○○○○○ 0.26 | 0.264640437632458 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,533,385 | 0.39 | 0.94 | ○○○○○ 0.38 | 0.379559764448478 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,533,385 | 0.46 | 0.95 | ○○○○○ 0.41 | 0.413401524761118 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,533,385 | 1.13 | 0.55 | ○○○○○ 0.77 | 0.765239425124839 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)