Bacterial taxon 909946
Locus STM474_3388
Protein WP_000384139.1
DUF805 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 121 aa, Gene yhaH, UniProt E8XBG2
>WP_000384139.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF805 domain-containing protein
MDWYLKVLKNYLGFGGRARRKEYWMFILVNIIFTFVLGLLDAMLGWQRAGGEGVLTTIYGVLIFLPWWAVQFRRLHDTDRSAWWLLLLLIPIIGWLIIIAFNCQNGTPGDNRFGPDPKRFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,420,515 | 0.51 | 0.51 | ○○○○○ 0.44 | 0.444214571505157 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,420,515 | 0.65 | 0.64 | ○○○○○ 0.51 | 0.512649001485088 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,420,515 | 1.4 | 0.69 | ○○○○○ 0.91 | 0.906096067524712 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)