Bacterial taxon 909946
Locus STM474_4265
Protein WP_000155237.1
DUF805 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 142 aa, Gene yiiR, UniProt E8XKF0
>WP_000155237.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF805 domain-containing protein
MTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLALFSLAGKNLLDIQTAAFCLVCLLWPTAAVMVKRLHDRGRSGAWALLMILAWMLLAGNWVMLPGMWQWVVGRFIPTLILVMMLIDLGAFVGVQGENKFGKATQDVKFKAEP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,313,695 | -0.01 | 1 | ○○○○○ 0.17 | 0.174126621420289 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,313,695 | 0.46 | 1 | ○○○○○ 0.42 | 0.418396871239261 | 23637626 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)