Bacterial taxon 909946
Locus STM474_3132
Protein WP_014343890.1
EamA family transporter RarD
Salmonella enterica Serovar Typhimurium ST4 74
Length 295 aa, Gene n/a, UniProt E8X8S1
>WP_014343890.1|Salmonella enterica Serovar Typhimurium ST4 74|EamA family transporter RarD
MFVVLAFILWGLTPLYYQYLSGGNLAQILIYRVFWSIPLLLAVRLLFRQRTRFHDAWKDKKSFFFCMIAGLLMIVSWSSFIYALTHHLVLDASLGYFINPLFVIALGCIFLKEKLSLFQAIAVFSGVCGLTFQIIMLRHFPALALTMGLSFALYGLARKFIHYDVMTSITIETLWALPVSLLIFLFSDTGPIISANTPFFLYVMTAPVTIIPLVLFAIALNHTSLIVTGLAQYIEPSLQFLLAIMIFGEHINYAELLCFCAVWFGLFLCISENLYSHYLRARLKPVFGRVQRFFR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,159,998 | -1.4 | 0.022 | ●○○○○ -0.55 | -0.547542585878518 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,160,228 | 2.14 | 0.0097 | ○○○○○ 1.29 | 1.29037151209728 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,160,154 | -0.49 | 0.51 | ●○○○○ -0.08 | -0.0768548790031818 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,160,228 | -0.48 | 0.87 | ●○○○○ -0.07 | -0.0738098070208237 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,160,149 | -0.43 | 0.89 | ●○○○○ -0.05 | -0.0471852962862984 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,160,154 | 0.25 | 0.87 | ○○○○○ 0.3 | 0.304964396482242 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,160,228 | 0.45 | 0.72 | ○○○○○ 0.41 | 0.41023867583492 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,159,998 | 0.67 | 0.7 | ○○○○○ 0.53 | 0.526374903492306 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,160,154 | 1.27 | 0.59 | ○○○○○ 0.84 | 0.83533030860102 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,159,998 | 1.29 | 0.92 | ○○○○○ 0.85 | 0.849214344537786 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,160,149 | 1.36 | 0.21 | ○○○○○ 0.88 | 0.882290012810552 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,160,149 | 1.41 | 0.053 | ○○○○○ 0.91 | 0.91083335353442 | 23637626 |
Retrieved 12 of 12 entries in 1.3 ms
(Link to these results)