Bacterial taxon 909946
Locus STM474_4097
Protein WP_000193413.1
ECA polysaccharide chain length modulation protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 348 aa, Gene wzzE, UniProt E8XIM9
>WP_000193413.1|Salmonella enterica Serovar Typhimurium ST4 74|ECA polysaccharide chain length modulation protein
MTQPLPGARAVSAENELDIRGLFRTLWAGKFWIIGIGLLFALIALAYTFFARQEWSATAITDRPTVNMLGGYYSQQQFLRNLDIKTDPASSDKPSVMDEAYKEFIMQLASWDTRRDFWLQTDYYKQRMVGNSKADAAMLDELINNIQFTPGDFTRAINDNVKLIAETAPDANNLLRQYVAFASQRAASHLNDELKGAWAARTVQMKAQVKRQEEVAKAIYSRRVNSIEQALKIAEQHNISRSATDVPADELPDSELFLLGRPMLQARLENLQAVGPAFDLDYFQNRAMLNTLNVGPTLDPRFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGALIGAGVALTRRRTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,150,737 | 1.44 | 0.048 | ○○○○○ 0.92 | 0.924064941149276 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,149,891 | -1.8 | 0.15 | ●○○○○ -0.76 | -0.756732493673137 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,150,414 | -1.36 | 0.051 | ●○○○○ -0.53 | -0.530760854284467 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,149,891 | -1.13 | 0.13 | ●○○○○ -0.41 | -0.407973134087005 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,150,737 | -0.93 | 0.66 | ●○○○○ -0.31 | -0.305822988228654 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,150,655 | -0.59 | 0.82 | ●○○○○ -0.13 | -0.130165449653133 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,150,655 | -0.13 | 0.93 | ○○○○○ 0.11 | 0.112013930556626 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,149,891 | 0.09 | 0.96 | ○○○○○ 0.22 | 0.222168685528793 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,150,414 | 0.15 | 0.86 | ○○○○○ 0.26 | 0.255935913792473 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,150,655 | 0.79 | 0.24 | ○○○○○ 0.59 | 0.586986214467609 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,150,414 | 0.96 | 0.87 | ○○○○○ 0.68 | 0.677233095122737 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,150,737 | 2.26 | 0.17 | ○○○○○ 1.35 | 1.3484471245709 | 23637626 |
Retrieved 12 of 12 entries in 2 ms
(Link to these results)