Bacterial taxon 909946
Locus STM474_1461
Protein WP_001289628.1
electron transport complex subunit E
Salmonella enterica Serovar Typhimurium ST4 74
Length 230 aa, Gene ydgQ, UniProt E8XI35
>WP_001289628.1|Salmonella enterica Serovar Typhimurium ST4 74|electron transport complex subunit E
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,486,576 | -3.29 | 0.0017 | ●●○○○ -1.53 | -1.52960097476808 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,486,576 | -3.07 | 2.4e-9 | ●●○○○ -1.42 | -1.41542667087433 | 23637626 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)