Bacterial taxon 909946
Locus STM474_3221
Protein WP_001520421.1
energy-coupling factor ABC transporter ATP-binding protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 225 aa, Gene n/a, UniProt E8X9P5
>WP_001520421.1|Salmonella enterica Serovar Typhimurium ST4 74|energy-coupling factor ABC transporter ATP-binding protein
MVTLEQFRYLPSDATRPPACFDFHYSTPGIVAIVGDNGSGKSTLAQLMAGWYPDYLPGDIDGTGLLLGVPIGRLPLVEQSPTIQLVQQSPYLQLSGCTFSVEEEVAFGPENLGLHEAEILRRIDEALTLTNCQSLRHRHPGTLSGGETQRVVIASALAMQPRLLILDEAFSRLTSAATGMLLERLQQWALERHSLIVLFERNHFPFLTRCQRVWQLRDGALTPLC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,255,749 | 2.36 | 0.026 | ○○○○○ 1.4 | 1.40229099508874 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,255,832 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.30860702729761 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,255,832 | 1.25 | 0.1 | ○○○○○ 0.83 | 0.828070408224067 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,255,749 | 1.89 | 0.43 | ○○○○○ 1.16 | 1.16049160265452 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,255,749 | 2.22 | 0.15 | ○○○○○ 1.33 | 1.33040252239626 | 23637626 |
Retrieved 5 of 5 entries in 0.5 ms
(Link to these results)