Bacterial taxon 909946
Locus STM474_2107
Protein WP_000753212.1
energy-coupling factor ABC transporter substrate-binding protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene cbiN, UniProt E8XBX6
>WP_000753212.1|Salmonella enterica Serovar Typhimurium ST4 74|energy-coupling factor ABC transporter substrate-binding protein
MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQAIAPQYKPWFQPLYEPASGEIESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,100,482 | 0.12 | 0.89 | ○○○○○ 0.24 | 0.237261283670428 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,100,482 | 0.96 | 0.75 | ○○○○○ 0.68 | 0.677851920412944 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,100,482 | 2 | 0.38 | ○○○○○ 1.22 | 1.21700903259545 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)