Bacterial taxon 909946
Locus STM474_0250
Protein WP_000252573.1
envelope stress response activation lipoprotein NlpE
Salmonella enterica Serovar Typhimurium ST4 74
Length 233 aa, Gene cutF, UniProt E8XIR1
>WP_000252573.1|Salmonella enterica Serovar Typhimurium ST4 74|envelope stress response activation lipoprotein NlpE
MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSWRGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSNGEKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFTDCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVFAANPDTGEPVKTLIADKNAKFAPGKDCTH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 282,215 | -0.51 | 0.36 | ●○○○○ -0.09 | -0.0881350330117933 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 282,044 | 0.19 | 0.98 | ○○○○○ 0.28 | 0.275683779453817 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 282,044 | 1 | 0.19 | ○○○○○ 0.69 | 0.694029236661705 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 282,044 | 1.01 | 0.43 | ○○○○○ 0.7 | 0.701451727207839 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 282,215 | 1.51 | 0.18 | ○○○○○ 0.96 | 0.958806049659563 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 282,215 | 2.01 | 0.22 | ○○○○○ 1.22 | 1.22253475831548 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)