Bacterial taxon 909946
Locus STM474_4241
Protein WP_001033731.1
envelope stress response regulator transcription factor CpxR
Salmonella enterica Serovar Typhimurium ST4 74
Length 232 aa, Gene cpxR, UniProt E8XKC6
>WP_001033731.1|Salmonella enterica Serovar Typhimurium ST4 74|envelope stress response regulator transcription factor CpxR
MNKILLVDDDRELTSLLKELLEMEGFNVLVAHDGEQALELLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQSSDNGSPTLEVDALSLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGHPWFKTLRGRGYLMVSAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,291,461 | -0.33 | 0.64 | ○○○○○ 0.01 | 0.005221762819877 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,291,702 | -0.11 | 0.97 | ○○○○○ 0.12 | 0.122299698138187 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,291,702 | 0.11 | 0.9 | ○○○○○ 0.23 | 0.233809409096841 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,291,461 | 0.56 | 0.89 | ○○○○○ 0.47 | 0.47013615289155 | 23637626 |
Retrieved 4 of 4 entries in 1.3 ms
(Link to these results)