Bacterial taxon 909946
Locus STM474_4577
Protein WP_000560303.1
esterase
Salmonella enterica Serovar Typhimurium ST4 74
Length 249 aa, Gene yjfP, UniProt E8XAQ5
>WP_000560303.1|Salmonella enterica Serovar Typhimurium ST4 74|esterase
MIAIETRQLAGGVVLHAFPEGKRAVPLPCVVFYHGFTSSSLVYSYFAVALAQAGFRVVMPDAPEHGARFGGDSQGRIHRFWQILHQNMQEFTTLRAAIQAENWLLDGRLAVGGASMGGMTALGIMTRHREVKCGASLMGSGYFTGLARTLFPPLSPQNPAQQAEFDNIIAPLREWEVTHQLERLADRPLLLWHGQEDDVVPAIETFRLQQALAAAKLDKHVTCLWAAGVRHRITPEALSATVAFFRQHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,643,364 | -0.61 | 0.86 | ●○○○○ -0.14 | -0.137118054371447 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,642,969 | -0.32 | 0.64 | ○○○○○ 0.01 | 0.00871680698770877 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,643,364 | 0.17 | 0.84 | ○○○○○ 0.26 | 0.264379934826883 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,642,865 | 0.32 | 0.95 | ○○○○○ 0.34 | 0.343755479525066 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,642,930 | 0.36 | 0.79 | ○○○○○ 0.36 | 0.361596506693322 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,642,969 | 0.4 | 0.76 | ○○○○○ 0.39 | 0.385278840906644 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,642,930 | 0.43 | 0.42 | ○○○○○ 0.4 | 0.401710518545073 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,643,364 | 0.54 | 0.7 | ○○○○○ 0.46 | 0.457642752459274 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,643,137 | 0.85 | 0.14 | ○○○○○ 0.62 | 0.619287084908494 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,643,137 | 0.92 | 0.45 | ○○○○○ 0.66 | 0.655946937201879 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,642,930 | 0.96 | 0.75 | ○○○○○ 0.67 | 0.673167208787104 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,642,865 | 1.17 | 0.12 | ○○○○○ 0.78 | 0.783366135111616 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,642,865 | 1.37 | 0.49 | ○○○○○ 0.89 | 0.891002166422439 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,643,137 | 1.52 | 0.44 | ○○○○○ 0.97 | 0.966161843577268 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,642,969 | 1.93 | 0.3 | ○○○○○ 1.18 | 1.17877812239946 | 23637626 |
Retrieved 15 of 15 entries in 1 ms
(Link to these results)