Bacterial taxon 909946
Locus STM474_3336
Protein WP_000105725.1
esterase YqiA
Salmonella enterica Serovar Typhimurium ST4 74
Length 193 aa, Gene yqiA, UniProt E8XBB1
>WP_000105725.1|Salmonella enterica Serovar Typhimurium ST4 74|esterase YqiA
MSTLLYLHGFNSSPRSAKACQLKNWLAERHPHVEMIVPQLPPYPADAAELLESLVLEHGGAPLGLVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLTDYLGQNENPYTGQQYVLESRHIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVTEGGNHAFTGFEDYFNQIVDFLGLHSC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,367,024 | 0.19 | 0.82 | ○○○○○ 0.27 | 0.274290333418048 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,367,024 | 0.53 | 0.9 | ○○○○○ 0.45 | 0.451687724837665 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,367,024 | 1.37 | 0.49 | ○○○○○ 0.89 | 0.887888531394539 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)