Bacterial taxon 909946
Locus STM474_2567
Protein WP_001522340.1
ethanolamine utilization microcompartment protein EutN
Salmonella enterica Serovar Typhimurium ST4 74
Length 95 aa, Gene eutN, UniProt E8XFS3
>WP_001522340.1|Salmonella enterica Serovar Typhimurium ST4 74|ethanolamine utilization microcompartment protein EutN
MKLAVVTGQIVCTVRHQGLAHDKLLMVEMIDAQGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDEVVAGGKVVFHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,572,561 | 1.21 | 0.022 | ○○○○○ 0.8 | 0.804715404831374 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,572,783 | -0.68 | 0.79 | ●○○○○ -0.17 | -0.17361883433358 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,572,783 | -0.27 | 0.74 | ○○○○○ 0.04 | 0.0372067647546861 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,572,561 | 0.01 | 1 | ○○○○○ 0.18 | 0.182158768755206 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,572,783 | 0.61 | 0.72 | ○○○○○ 0.49 | 0.492831926750688 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,572,561 | 0.76 | 0.83 | ○○○○○ 0.57 | 0.572141578200317 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)