Bacterial taxon 909946
Locus STM474_2641
Protein WP_000523621.1
Fe-S cluster assembly protein IscX
Salmonella enterica Serovar Typhimurium ST4 74
Length 66 aa, Gene n/a, UniProt E8XGM8
>WP_000523621.1|Salmonella enterica Serovar Typhimurium ST4 74|Fe-S cluster assembly protein IscX
MGLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDDPNASNEKILEAILLVWLDEAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,675,522 | 0.31 | 0.88 | ○○○○○ 0.34 | 0.335960897903064 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,675,522 | 0.47 | 0.94 | ○○○○○ 0.42 | 0.421267969154408 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,675,522 | 0.56 | 0.48 | ○○○○○ 0.47 | 0.467938241612439 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)