Bacterial taxon 909946
Locus STM474_2357
Protein WP_000228070.1
ferredoxin-type protein NapF
Salmonella enterica Serovar Typhimurium ST4 74
Length 163 aa, Gene napF, UniProt E8XEA4
>WP_000228070.1|Salmonella enterica Serovar Typhimurium ST4 74|ferredoxin-type protein NapF
MVDLSRRSMLTGSWRNASNGILPPWARETTYFLAHCLRCDACIQACEADILQRGAGGYPSVDFKRGECSFCYACAQACTESLFLPRHTRAWDLVFTLTENCLARQSVECHRCQDSCEPMAITFRPTLSGIYQPQLDSQACNGCGACVAICPVSAIKAENHHAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,357,232 | -0.13 | 0.85 | ○○○○○ 0.11 | 0.110606901844293 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,357,232 | 0.12 | 1 | ○○○○○ 0.24 | 0.24027291801644 | 23637626 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)