Bacterial taxon 909946
Locus STM474_3175
Protein WP_000798504.1
fimbrial chaperone protein StdC
Salmonella enterica Serovar Typhimurium ST4 74
Length 247 aa, Gene stdC, UniProt E8X9K0
>WP_000798504.1|Salmonella enterica Serovar Typhimurium ST4 74|fimbrial chaperone protein StdC
MKNSRRSRVILLALAAAWSQYSPAAVNVDRTRIIMDAPQKTVAITLNNDDKTTPFLAQSWVTDADGVRTDALMALPPLQRIDAGQKSQVRITQVRGLTDKLPQDRETLFWFNVRGVPPKPEDDNVLQLAMQSQLKLFYRPKAIIRSSSDQPERKLTAERNAGHLTLRNPTPYYITVAWLGADRSHRLSGFREGVMVPPLGNLPLKAVLPAETRTLWVGYIDDYGGLQMNRYTCDALNCAFKDAGATS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,209,607 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.161968867075977 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,209,607 | 0.91 | 0.62 | ○○○○○ 0.65 | 0.651860465749965 | 23637626 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)