Bacterial taxon 909946
Locus STM474_0206
Protein WP_000987334.1
fimbrial chaperone StfD
Salmonella enterica Serovar Typhimurium ST4 74
Length 250 aa, Gene stfD, UniProt E8XHZ5
>WP_000987334.1|Salmonella enterica Serovar Typhimurium ST4 74|fimbrial chaperone StfD
MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISVDLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQDRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQGNGYQVSNTTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYVNDYGARLPLIFNCTDNSCAVDEAKSRKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 233,995 | -1.04 | 0.16 | ●○○○○ -0.37 | -0.365114631172173 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 234,591 | 0.17 | 0.84 | ○○○○○ 0.26 | 0.264017217901069 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 234,591 | 0.17 | 0.99 | ○○○○○ 0.27 | 0.265738354642569 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 234,591 | 0.24 | 0.9 | ○○○○○ 0.3 | 0.302296467469371 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 234,155 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.306085899728415 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 233,995 | 0.36 | 0.95 | ○○○○○ 0.36 | 0.363452857409096 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 234,155 | 0.46 | 0.44 | ○○○○○ 0.42 | 0.418200270629594 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 233,995 | 0.93 | 0.52 | ○○○○○ 0.66 | 0.659795359458871 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 234,155 | 1.29 | 0.26 | ○○○○○ 0.85 | 0.84899806086151 | 23637626 |
Retrieved 9 of 9 entries in 1.5 ms
(Link to these results)