Bacterial taxon 909946
Locus STM474_0186
Protein WP_000777532.1
fimbrial protein StiA
Salmonella enterica Serovar Typhimurium ST4 74
Length 179 aa, Gene stiA, UniProt E8XHX5
>WP_000777532.1|Salmonella enterica Serovar Typhimurium ST4 74|fimbrial protein StiA
MKLSLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTVKTDSVEVTLQEEFASLFTAAGQTAGDTDFTIELENCDANVYSSVQARFEGTLDGTDATILKNEDDAENIGVQILDKTSTPMTFNDLQAWSAPVNLPTAEGVTELSMPFTARYIATAVPVKSGTVDATATFYLQYN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 208,822 | -4.15 | 1.6e-14 | ●●○○○ -1.98 | -1.97850435186044 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 208,499 | 1.86 | 0.016 | ○○○○○ 1.14 | 1.14334019012423 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 208,822 | -0.58 | 0.94 | ●○○○○ -0.13 | -0.125756166457305 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 208,499 | -0.04 | 0.98 | ○○○○○ 0.15 | 0.154089032671885 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 208,822 | 0.24 | 0.98 | ○○○○○ 0.3 | 0.304089053607639 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 208,499 | 1.02 | 0.89 | ○○○○○ 0.71 | 0.706313486724732 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)