Bacterial taxon 909946
Locus STM474_3619
Protein WP_000838227.1
FKBP-type peptidyl-prolyl cis-trans isomerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 272 aa, Gene fkpA, UniProt E8XDZ8
>WP_000838227.1|Salmonella enterica Serovar Typhimurium ST4 74|FKBP-type peptidyl-prolyl cis-trans isomerase
MKSLFKATLLATTMAVAMHAPITFAADAAKPAATADSKAAFKNDDQKAAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQTFEARVKSAAQAKMEKDAADNEAKGKTFRDAFAKEKGVKTSSTGLLYKVEKEGTGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKTGVPGIPANSTLVFDVELLDIKPAPKADAKPADAADAKAADAAKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,627,061 | -0.29 | 0.94 | ○○○○○ 0.03 | 0.0286010498883052 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,627,061 | -0.18 | 0.9 | ○○○○○ 0.09 | 0.085496697780198 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,626,682 | 0.05 | 1 | ○○○○○ 0.2 | 0.203052172586706 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,626,682 | 1.21 | 0.062 | ○○○○○ 0.81 | 0.806261939654163 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,626,682 | 1.38 | 0.47 | ○○○○○ 0.89 | 0.892803976628806 | 23637626 |
Retrieved 5 of 5 entries in 1.9 ms
(Link to these results)