Bacterial taxon 909946
Locus STM474_1986
Protein WP_000218080.1
flagella biosynthesis regulatory protein FliZ
Salmonella enterica Serovar Typhimurium ST4 74
Length 183 aa, Gene fliZ, UniProt E8XA97
>WP_000218080.1|Salmonella enterica Serovar Typhimurium ST4 74|flagella biosynthesis regulatory protein FliZ
MTVQQPKRRPLSRYLKDFKHSQTHCAHCHKLLDRITLVRRGKIVNKIAISQLDMLLDDAAWQREQKEWVALCRFCGDLHCKKQSDFFDIIGFKQYLFEQTEMSHGTVREYVVRLRRLGNYLSEQNISHDLLQDGFLDESLAPWLPETSTNNYRIALRKYQQYKAHQQIAPRQKSPFTASSDIY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,001,786 | -5.88 | 2.5e-7 | ●●●○○ -2.87 | -2.87489143409659 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,001,786 | -3.62 | 4.5e-11 | ●●○○○ -1.7 | -1.70028339365458 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,001,786 | 0.88 | 0.78 | ○○○○○ 0.63 | 0.633331305029333 | 23637626 |
Retrieved 3 of 3 entries in 0.3 ms
(Link to these results)