Bacterial taxon 909946
Locus STM474_1176
Protein WP_001174897.1
flagellar basal body L-ring protein FlgH
Salmonella enterica Serovar Typhimurium ST4 74
Length 232 aa, Gene flgH, UniProt E8XEU9
>WP_001174897.1|Salmonella enterica Serovar Typhimurium ST4 74|flagellar basal body L-ring protein FlgH
MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,219,340 | -2.11 | 0.089 | ●○○○○ -0.92 | -0.92091504693564 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,219,340 | -0.15 | 0.96 | ○○○○○ 0.1 | 0.0985186359643574 | 23637626 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)