Bacterial taxon 909946
Locus STM474_1170
Protein WP_000887043.1
flagellar basal body rod protein FlgB
Salmonella enterica Serovar Typhimurium ST4 74
Length 138 aa, Gene flgB, UniProt E8XEU3
>WP_000887043.1|Salmonella enterica Serovar Typhimurium ST4 74|flagellar basal body rod protein FlgB
MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,214,681 | -4.1 | 3.5e-25 | ●●○○○ -1.95 | -1.95058027317046 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,214,681 | -2.83 | 0.065 | ●●○○○ -1.29 | -1.29018682289689 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,214,681 | 0.05 | 1 | ○○○○○ 0.2 | 0.203265065657159 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)