Bacterial taxon 909946
Locus STM474_1171
Protein WP_001196448.1
flagellar basal body rod protein FlgC
Salmonella enterica Serovar Typhimurium ST4 74
Length 134 aa, Gene flgC, UniProt E8XEU4
>WP_001196448.1|Salmonella enterica Serovar Typhimurium ST4 74|flagellar basal body rod protein FlgC
MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,215,191 | -1.36 | 0.28 | ●○○○○ -0.53 | -0.527552499367088 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,215,191 | 1 | 0.19 | ○○○○○ 0.69 | 0.694644667191572 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,215,191 | 1.67 | 0.36 | ○○○○○ 1.04 | 1.04304160430334 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)