Bacterial taxon 909946
Locus STM474_1993
Protein WP_000287764.1
flagellar export chaperone FliS
Salmonella enterica Serovar Typhimurium ST4 74
Length 135 aa, Gene fliS, UniProt E8XAA4
>WP_000287764.1|Salmonella enterica Serovar Typhimurium ST4 74|flagellar export chaperone FliS
MYTASGIKAYAQVSVESAVMSASPHQLIEMLFDGANSALVRARLFLEQGDVVAKGEALSKAINIIDNGLKAGLDQEKGGEIATNLSELYDYMIRRLLQANLRNDAQAIEEVEGLLSNIAEAWKQISPKASFQESR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,008,783 | -1.8 | 0.15 | ●○○○○ -0.76 | -0.755655777167254 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,008,783 | -0.38 | 0.9 | ●○○○○ -0.02 | -0.0181465184116391 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,008,783 | 0.98 | 0.19 | ○○○○○ 0.69 | 0.685576400779197 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)