Bacterial taxon 909946
Locus STM474_3109
Protein WP_000807739.1
flavodoxin
Salmonella enterica Serovar Typhimurium ST4 74
Length 149 aa, Gene n/a, UniProt E8X8P8
>WP_000807739.1|Salmonella enterica Serovar Typhimurium ST4 74|flavodoxin
MAEIGIFVGTMYGNSLLVAEEAEAILARQGHSATVFEDPELSDWQQYQDKVALVVTSTTGQGDLPDSIAPLFHGIKDTVGFQPNLRYGVIALGDSSYPNFCNGGKQFDALLQEQSAQRVGEMLFIDASEHPEPESQSNPWVENWGTLLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,136,668 | 1.8 | 0.03 | ○○○○○ 1.11 | 1.1129442626777 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,136,873 | 2.53 | 0.00083 | ○○○○○ 1.49 | 1.49277662757161 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,136,668 | 0.14 | 0.92 | ○○○○○ 0.25 | 0.249969616002758 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,136,668 | 0.6 | 0.89 | ○○○○○ 0.49 | 0.486187738891497 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,136,873 | 1.1 | 0.78 | ○○○○○ 0.75 | 0.747736323316864 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,136,873 | 1.51 | 0.51 | ○○○○○ 0.96 | 0.962249005522107 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)