Bacterial taxon 909946
Locus STM474_3192
Protein WP_001055885.1
flavodoxin FldB
Salmonella enterica Serovar Typhimurium ST4 74
Length 173 aa, Gene fldB, UniProt E8X9L6
>WP_001055885.1|Salmonella enterica Serovar Typhimurium ST4 74|flavodoxin FldB
MNMGLFYGSSTCYTEMAAEKIRDILGPELVTLHNLKDDAPALMEQYDVLILGIPTWDFGEIQEDWEAVWEQLDDLNLEGKIVALYGMGDQLGYGEWFLDALGMLHDKLALKGVKFVGYWPTEGYEFTSNKPVIADGQLFVGLALDETNQYDLSDERIQTWCEQILGEMAEHYA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,226,191 | -0.77 | 0.52 | ●○○○○ -0.22 | -0.223533687026767 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,226,339 | -0.72 | 0.35 | ●○○○○ -0.2 | -0.195593210974428 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,226,191 | 0.24 | 0.97 | ○○○○○ 0.3 | 0.299373766808203 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,226,339 | 1.18 | 0.49 | ○○○○○ 0.79 | 0.791480341962395 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,226,339 | 1.22 | 0.62 | ○○○○○ 0.81 | 0.813077720003248 | 23637626 |
Retrieved 5 of 5 entries in 1.4 ms
(Link to these results)