Bacterial taxon 909946
Locus STM474_4054
Protein WP_000763722.1
FMN-binding protein MioC
Salmonella enterica Serovar Typhimurium ST4 74
Length 147 aa, Gene mioC, UniProt E8XIJ5
>WP_000763722.1|Salmonella enterica Serovar Typhimurium ST4 74|FMN-binding protein MioC
MADITLISGSTLGGAEYVAEHLAEKLEAAGFSTETVHGPLLEDLSTSGIWLIISSTHGAGDIPDNLTPFYEDLQTQKPDLSAVRFGAIGIGSREYDTFCGAIEKIEAELKGAGAKQVGETLKINILEHEIPEDPAEIWLGSWINLLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,105,779 | 1.75 | 0.023 | ○○○○○ 1.09 | 1.08536890382382 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,105,887 | -0.67 | 0.8 | ●○○○○ -0.17 | -0.173416334827981 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,105,887 | -0.13 | 0.88 | ○○○○○ 0.11 | 0.107251016884682 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,105,779 | 0.31 | 0.81 | ○○○○○ 0.34 | 0.338090736889047 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,105,887 | 0.45 | 0.82 | ○○○○○ 0.41 | 0.411084485281259 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,105,779 | 0.56 | 0.89 | ○○○○○ 0.47 | 0.469827882998493 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)