Bacterial taxon 909946
Locus STM474_1581
Protein WP_000045657.1
formate dehydrogenase-N subunit gamma
Salmonella enterica Serovar Typhimurium ST4 74
Length 218 aa, Gene fdnI, UniProt E8XJ16
>WP_000045657.1|Salmonella enterica Serovar Typhimurium ST4 74|formate dehydrogenase-N subunit gamma
MSKSKMIVRTKFVDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFIALMFMFVRFVHHNIPDKKDIPWLKNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILMHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGIQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,605,864 | -0.59 | 0.89 | ●○○○○ -0.13 | -0.129937994478548 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,605,864 | -0.42 | 0.85 | ●○○○○ -0.04 | -0.0403762535264215 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,606,021 | -0.35 | 0.54 | ●○○○○ -0 | -0.00459452088345965 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,606,021 | 0.66 | 0.88 | ○○○○○ 0.52 | 0.518690384913258 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,605,864 | 0.83 | 0.28 | ○○○○○ 0.61 | 0.608804567673941 | 23637626 |
Retrieved 5 of 5 entries in 1.5 ms
(Link to these results)