Bacterial taxon 909946
Locus STM474_2991
Protein WP_000158074.1
formate hydrogenlyase regulator HycA
Salmonella enterica Serovar Typhimurium ST4 74
Length 153 aa, Gene hycA, UniProt E8XKY0
>WP_000158074.1|Salmonella enterica Serovar Typhimurium ST4 74|formate hydrogenlyase regulator HycA
MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPERDLCFVLFEHFRIYVALADGFNSHTIEYYVETKDGEDKQLIAQAQLDIDGKVDERVNNRDREQVLEHYLEKIASVYDSLYTAVETNSPVNLRQLVKGHSPAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,021,705 | 1.72 | 0.033 | ○○○○○ 1.07 | 1.06834774373494 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,021,705 | 0.5 | 0.72 | ○○○○○ 0.44 | 0.435502450090783 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,021,786 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.53976650651395 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,021,705 | 0.93 | 0.81 | ○○○○○ 0.66 | 0.661695681071507 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,021,786 | 1.23 | 0.15 | ○○○○○ 0.81 | 0.814609077853274 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,021,786 | 1.59 | 0.42 | ○○○○○ 1 | 1.00037782311751 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)