Bacterial taxon 909946
Locus STM474_2985
Protein WP_000067419.1
formate hydrogenlyase subunit HycG
Salmonella enterica Serovar Typhimurium ST4 74
Length 255 aa, Gene hycG, UniProt E8XK86
>WP_000067419.1|Salmonella enterica Serovar Typhimurium ST4 74|formate hydrogenlyase subunit HycG
MSNLLGPRDANGIPVPMTVDESIASMKASLLKNIKRSAYVYRVDCGGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLLEQKIHARAPGELDDQPAEILHPDMVQPLRVKVDRAARRLAGYRYGRQIADDYLTQLGQGEQQVARWLEAENDPRLTEIVTHLNHVVEEARIR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,015,301 | 3.4 | 1.4e-5 | ○○○○○ 1.94 | 1.94388761881936 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,015,301 | 0.69 | 0.57 | ○○○○○ 0.53 | 0.532967881207405 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,015,301 | 0.75 | 0.83 | ○○○○○ 0.56 | 0.564611974838168 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,015,534 | 1.31 | 0.06 | ○○○○○ 0.86 | 0.855961306338487 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,015,534 | 1.98 | 0.11 | ○○○○○ 1.2 | 1.20474354121883 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,015,534 | 2.32 | 0.13 | ○○○○○ 1.38 | 1.37971551840779 | 23637626 |
Retrieved 6 of 6 entries in 1 ms
(Link to these results)