Bacterial taxon 909946
Locus STM474_0960
Protein WP_000642539.1
formate transporter FocA
Salmonella enterica Serovar Typhimurium ST4 74
Length 285 aa, Gene focA, UniProt E8XCT0
>WP_000642539.1|Salmonella enterica Serovar Typhimurium ST4 74|formate transporter FocA
MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTGAMPYGMAKLIGGICFSLGLILCVICGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLIGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKMHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFATPEFWTAVGSSPESFSHLTVMSFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRGNEHH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,014,600 | -7.95 | 7.3e-9 | ●●●●○ -3.95 | -3.94985536548292 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,014,600 | -1.67 | 0.12 | ●○○○○ -0.69 | -0.69247501898441 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,014,600 | 0.16 | 0.83 | ○○○○○ 0.26 | 0.258029707143573 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)