Bacterial taxon 909946
Locus STM474_1773
Protein WP_001191156.1
formyltetrahydrofolate deformylase
Salmonella enterica Serovar Typhimurium ST4 74
Length 280 aa, Gene purU, UniProt E8XKX3
>WP_001191156.1|Salmonella enterica Serovar Typhimurium ST4 74|formyltetrahydrofolate deformylase
MQSLQRKVLRTICPDQKGLIARITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIFNDSTLLADLDSALPEGSVRELNPAGRRRVVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHETLRSLVERFEIPFELVSHEGLTREEHDTKMADAIDAHQPDYVVLAKYMRVLTPGFVARFPNKIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAEDMMRAGRDVEKNVLSRALYQVLAQRVFVYGNRTIIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,809,223 | 2.14 | 0.0038 | ○○○○○ 1.29 | 1.28774356720214 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,809,211 | -1.12 | 0.15 | ●○○○○ -0.4 | -0.404260392668223 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,809,211 | -0.31 | 0.86 | ○○○○○ 0.02 | 0.0176756257450768 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,809,211 | 0.26 | 0.97 | ○○○○○ 0.31 | 0.311369916642677 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,809,223 | 1.19 | 0.63 | ○○○○○ 0.8 | 0.795772093330932 | 23637626 |
Retrieved 5 of 5 entries in 1.3 ms
(Link to these results)