Bacterial taxon 909946
Locus STM474_4294
Protein WP_000424866.1
fructose-6-phosphate aldolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 220 aa, Gene talC, UniProt E8XL66
>WP_000424866.1|Salmonella enterica Serovar Typhimurium ST4 74|fructose-6-phosphate aldolase
MELYLDTANVAEVERLARIFPIAGVTTNPSIVAASKESIWDVLPRLQNAIGEEGTLFAQTMSRDAKGMVEEAKRLNNAIPGIVVKIPVTAEGLAAIKLLKKEGIVTLGTAVYSASQGLLAALAGAKYVAPYVNRVDAQGGDGIRMVQELQTLLEHHAPDSMVLAASFKTPRQALDCLLAGCQAITLPLDVAQQMLNTPAVESAIEKFEQDWKNAFGNLNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,345,502 | -0.7 | 0.84 | ●○○○○ -0.19 | -0.187395111426817 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,345,502 | -0.61 | 0.15 | ●○○○○ -0.14 | -0.14108645079287 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,345,462 | 0.05 | 0.84 | ○○○○○ 0.2 | 0.202124917973822 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,345,462 | 0.42 | 0.94 | ○○○○○ 0.39 | 0.39494603973947 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,345,736 | 0.44 | 0.57 | ○○○○○ 0.41 | 0.406349099963435 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,345,736 | 0.55 | 0.89 | ○○○○○ 0.47 | 0.465151935847223 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,345,462 | 0.93 | 0.21 | ○○○○○ 0.66 | 0.662623358406575 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,345,502 | 1.06 | 0.43 | ○○○○○ 0.73 | 0.725458233250333 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,345,736 | 1.68 | 0.47 | ○○○○○ 1.05 | 1.05020226467547 | 23637626 |
Retrieved 9 of 9 entries in 2.1 ms
(Link to these results)