Bacterial taxon 909946
Locus STM474_1077
Protein WP_000374050.1
FtsH protease modulator YccA
Salmonella enterica Serovar Typhimurium ST4 74
Length 219 aa, Gene ycca, UniProt E8XE42
>WP_000374050.1|Salmonella enterica Serovar Typhimurium ST4 74|FtsH protease modulator YccA
MDRIITSSRDRSSLLSTHKVLRNTYFLLSLTLALSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPVGILSAFAFTGFLGYILGPILNAYLSAGMGDVIGLALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILYETSNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,131,151 | -1.5 | 0.00069 | ●○○○○ -0.6 | -0.6026828352401 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,131,151 | -1.2 | 0.47 | ●○○○○ -0.45 | -0.445218348587829 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,131,151 | 0.7 | 0.59 | ○○○○○ 0.54 | 0.540159670861939 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,130,845 | 0.97 | 0.053 | ○○○○○ 0.68 | 0.683357309249132 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,130,845 | 1.01 | 0.81 | ○○○○○ 0.7 | 0.700073269114274 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,130,845 | 1.79 | 0.18 | ○○○○○ 1.11 | 1.1066969325328 | 23637626 |
Retrieved 6 of 6 entries in 1.1 ms
(Link to these results)