Bacterial taxon 909946
Locus STM474_4537
Protein WP_000609649.1
fumarate reductase subunit FrdD
Salmonella enterica Serovar Typhimurium ST4 74
Length 119 aa, Gene frdD, UniProt E8XAL9
>WP_000609649.1|Salmonella enterica Serovar Typhimurium ST4 74|fumarate reductase subunit FrdD
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVISL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,603,182 | -6.38 | 1.7e-5 | ●●●●○ -3.14 | -3.1357337198599 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,603,182 | 1.24 | 0.026 | ○○○○○ 0.82 | 0.82238379309057 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,603,182 | -0.68 | 0.75 | ●○○○○ -0.18 | -0.175626998918731 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)