Bacterial taxon 909946
Locus STM474_3366
Protein WP_000237776.1
G/U mismatch-specific DNA glycosylase
Salmonella enterica Serovar Typhimurium ST4 74
Length 168 aa, Gene mug, UniProt E8XBE1
>WP_000237776.1|Salmonella enterica Serovar Typhimurium ST4 74|G/U mismatch-specific DNA glycosylase
MVKDILAPGLRVVFCGINPGLSSANTGFPFAHPANRFWKVIHLAGFTDRQLKPEEAEKLLDFRCGVTKLVDRPTVQATEVKLHELRSGGRNLIEKIEDYQPAALAVLGKQAFEQGFSQRGIAWGKQKIAIGATMVWVLPNPSGLNRIKTEKLVEAYRELDQALIMRGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,399,573 | 2.48 | 0.003 | ○○○○○ 1.46 | 1.46266211209932 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,399,573 | 0.75 | 0.58 | ○○○○○ 0.57 | 0.568264756698415 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,399,573 | 0.83 | 0.8 | ○○○○○ 0.61 | 0.608849220950347 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)