Bacterial taxon 909946
Locus STM474_3708
Protein WP_000108342.1
gluconokinase
Salmonella enterica Serovar Typhimurium ST4 74
Length 177 aa, Gene n/a, UniProt E8XEP4
>WP_000108342.1|Salmonella enterica Serovar Typhimurium ST4 74|gluconokinase
MSTTNHDHHVYVLMGVSGSGKSAVASAVAHQLHAAFLDGDFLHPRCNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKISLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADERDVLVVDIDQPLEGVVASTIEVINKGSTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,733,255 | -0.89 | 0.67 | ●○○○○ -0.28 | -0.282885855581868 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,733,255 | 0.12 | 0.83 | ○○○○○ 0.24 | 0.236875282230406 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,733,255 | 0.29 | 0.83 | ○○○○○ 0.33 | 0.327123423262364 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)